Stories about #vape

Instagram #vape hashtag medias

@Regrann from @snipez_vapez - Genau mein Geschmack 😍 Respekt 🤙 Design sowie Geschmack absoluter Hammer 👌 vielen lieben dank an @xeovape
👑 follow the kings 👑
•
@cloudkings_austria
@cloudkings_
@cloudkings_germany
•
🇦🇹 AUSTRIAN CHAPTER 🇦🇹 •
@vienna_vapeteam
@autvapeteam
@vienna_vaper
@vienna_coils
@casual_dryhit
@max_vpr
@le_bierbaum_photography
@vapors_lifestyle
@king_of_coils
@quentin_lobo
@ziggy_vapes
@r3uzel_
@austriavape
@vape_on_and_have_fun
@to.koenig.m
@kathi_vapes
@austrianvapeaholic
@snipez_vapez

#vape #vapelife #vaping #vapenation #vapeporn #vapecommunity #vapefam #vapeon #instavape #vapestagram #vapepics #eliquid #vapefamily #vapedaily #ejuice #vapor #vapefriends #cloudchaser #vapelyfe #vapelove #Vape #vapers #liquid #juice #cloudkings_austria #cloudkings #vapegaming #vapelifestyle #subohm

@Regrann from @snipez_vapez - Genau mein Geschmack 😍 Respekt 🤙 Design sowie Geschmack absoluter Hammer 👌 vielen lieben dank an @xeovape 👑 follow the kings 👑 • @cloudkings_austria @cloudkings_ @cloudkings_germany • 🇦🇹 AUSTRIAN CHAPTER 🇦🇹 • @vienna_vapeteam @autvapeteam @vienna_vaper @vienna_coils @casual_dryhit @max_vpr @le_bierbaum_photography @vapors_lifestyle @king_of_coils @quentin_lobo @ziggy_vapes @r3uzel_ @austriavape @vape_on_and_have_fun @to.koenig.m @kathi_vapes @austrianvapeaholic @snipez_vapez #vape  #vapelife  #vaping  #vapenation  #vapeporn  #vapecommunity  #vapefam  #vapeon  #instavape  #vapestagram  #vapepics  #eliquid  #vapefamily  #vapedaily  #ejuice  #vapor  #vapefriends  #cloudchaser  #vapelyfe  #vapelove  #Vape  #vapers  #liquid  #juice  #cloudkings_austria  #cloudkings  #vapegaming  #vapelifestyle  #subohm 

Let’s show this sexy vaper some love 💕 follow 👉🏻 @queenb_clouds - Follow the fam:
@dripnvape_inc 💦
@vapemaponline 😎💨 #girlsofidrip 💦 -----------------------------
#CRUWW 
#CLOUDRIDERZUNIQUEWW
-----------------------------
@kismet_kobain (PREZ)
@metaltatsanvaping (VP) 
@shilumz
@le_zap
@chasingg00se3ggs
@karma1369 
@queenb_clouds 
@vlka_fenryka40 •
•
•
#vape #vapeporn #clouds #sexyvapers #vapelife #vapemaponline #girlswhovape #vapecommunity #vapefam #modlife  #vapehard #instavape #vapephotography  #vape #vapeon #vapeallday  #vapenation #vapefriends  #instavape #vapeclassy #vapersunite #DripNvape vapegram  #vapemodels 💋💋

Let’s show this sexy vaper some love 💕 follow 👉🏻 @queenb_clouds - Follow the fam: @dripnvape_inc 💦 @vapemaponline 😎💨 #girlsofidrip  💦 ----------------------------- #CRUWW  #CLOUDRIDERZUNIQUEWW  ----------------------------- @kismet_kobain (PREZ) @metaltatsanvaping (VP) @shilumz @le_zap @chasingg00se3ggs @karma1369 @queenb_clouds @vlka_fenryka40 • • • #vape  #vapeporn  #clouds  #sexyvapers  #vapelife  #vapemaponline  #girlswhovape  #vapecommunity  #vapefam  #modlife  #vapehard  #instavape  #vapephotography  #vape  #vapeon  #vapeallday  #vapenation  #vapefriends  #instavape  #vapeclassy  #vapersunite  #DripNvape  vapegram #vapemodels  💋💋

🌟🌟🌟 S T A R V A P E R S 🌟🌟🌟 ————————————————————
⚡️ Pods System ✖️ Salt Nic ⚡️
————————————————————
❇️ Get back to basics with Cuban Cacao Salt Juice from @aalivaporshop . This tobacco vape juice is fantastic for anyone who enjoys a simple, familiar tobacco flavor. All of SaltNic's vape juices are made with nicotine salts, giving them an unparalleled smoothness upon inhalation. Now available for grab at Star Vapers. Available in 35mg! ❇️ ————————————————————
🔥 Cuban Cacao————————————————————
🏪 Star Vapers HQ

No 20, Ground Floor, 
Kompleks Perniagaan Utama, 
Jalan Sultanah Sambungan,
05350 Alor Star, 
Kedah Darul Aman
📱 0194525757
————————————————————
SUNDAY - THURSDAY ⌛️ 12pm - 1am
FRIDAY - SATURDAY ⌛️ 4pm - 1am
————————————————————
🗺 Waze: Star Vapers ————————————————————
📍https://waze.to/lr/hw1p6gy7f9 ————————————————————
( Landmark: Tat Nasi Ayam ) ————————————————————
"All Vapers Are Brothers"
————————————————————
#starvapers #mrjuicer #starvapersfamilia #allvapersarebrothers #vape #vapeon #vapers #vapeup #vaping #vapefam #vapehead #vapelife #vapelyfe #vapeporn #vapedaily #vapejuice #vapeaddict #vapeallday #vapefamily #vapefamous #makeclouds #malaysianvapers #vapeutara #vapekedah #ecigs #eliquid #instavape #vapenewsmalaysia #saltnic #pods

🌟🌟🌟 S T A R V A P E R S 🌟🌟🌟 ———————————————————— ⚡️ Pods System ✖️ Salt Nic ⚡️ ———————————————————— ❇️ Get back to basics with Cuban Cacao Salt Juice from @aalivaporshop . This tobacco vape juice is fantastic for anyone who enjoys a simple, familiar tobacco flavor. All of SaltNic's vape juices are made with nicotine salts, giving them an unparalleled smoothness upon inhalation. Now available for grab at Star Vapers. Available in 35mg! ❇️ ———————————————————— 🔥 Cuban Cacao———————————————————— 🏪 Star Vapers HQ No 20, Ground Floor, Kompleks Perniagaan Utama, Jalan Sultanah Sambungan, 05350 Alor Star, Kedah Darul Aman 📱 0194525757 ———————————————————— SUNDAY - THURSDAY ⌛️ 12pm - 1am FRIDAY - SATURDAY ⌛️ 4pm - 1am ———————————————————— 🗺 Waze: Star Vapers ———————————————————— 📍https://waze.to/lr/hw1p6gy7f9 ———————————————————— ( Landmark: Tat Nasi Ayam ) ———————————————————— "All Vapers Are Brothers" ———————————————————— #starvapers  #mrjuicer  #starvapersfamilia  #allvapersarebrothers  #vape  #vapeon  #vapers  #vapeup  #vaping  #vapefam  #vapehead  #vapelife  #vapelyfe  #vapeporn  #vapedaily  #vapejuice  #vapeaddict  #vapeallday  #vapefamily  #vapefamous  #makeclouds  #malaysianvapers  #vapeutara  #vapekedah  #ecigs  #eliquid  #instavape  #vapenewsmalaysia  #saltnic  #pods 

And we're so ready to bring you guys these @boomcoils 💥💣💥
Specs 👇🏻
2 X 28 / 36, 36 KPN80
0,219 ohms in dual
Push up the wattage on your VW device anything between 110 - 125 Watts and vape on some Custard, Pudding type of dessert flavours - ENJOY! 😉
----------------------------------💥💣💥----------------------------------
📸 Photo Cred to the TALENTED Mrs Boom!
----------------------------------💥💣💥----------------------------------
#vape #vapelifestyle #vapelife #vapestagram #photooftheday #followme #like4like #vapelove #vapegirl #coilporn #vapefam #vaper #vaping #vapeon #vapecommunity #vapenation #teamboomcoils #vapelyfe #vapecpt #vapejhb #vapeporn #vapepics #mechlife #proudlysa #productoftheday

And we're so ready to bring you guys these @boomcoils 💥💣💥 Specs 👇🏻 2 X 28 / 36, 36 KPN80 0,219 ohms in dual Push up the wattage on your VW device anything between 110 - 125 Watts and vape on some Custard, Pudding type of dessert flavours - ENJOY! 😉 ----------------------------------💥💣💥---------------------------------- 📸 Photo Cred to the TALENTED Mrs Boom! ----------------------------------💥💣💥---------------------------------- #vape  #vapelifestyle  #vapelife  #vapestagram  #photooftheday  #followme  #like4like  #vapelove  #vapegirl  #coilporn  #vapefam  #vaper  #vaping  #vapeon  #vapecommunity  #vapenation  #teamboomcoils  #vapelyfe  #vapecpt  #vapejhb  #vapeporn  #vapepics  #mechlife  #proudlysa  #productoftheday 

Chillllll edit for my fam @trapt_e_liquid & @vitality_mods. By farr the best combo I’ve ever owned!! Hope y’all enjoy the edit! 
Check out @zarati_mulisha_az #vape #vapetricks #vapeporn #vapenation #vaper #vapes #vapers #vapeon #vapefam #vapelife #vgod #vgodnation #vgodtricklyfe #indovape #malaysianvapers #graffitiart #vapecommunity #vaping #vapingtricks #vapingcommunity #coilporn #driplyfe #handcheck #handchecks #vapefriends #malaysiavape #indonesiavapor #instavape #satisfying

Chillllll edit for my fam @trapt_e_liquid & @vitality_mods. By farr the best combo I’ve ever owned!! Hope y’all enjoy the edit! Check out @zarati_mulisha_az #vape  #vapetricks  #vapeporn  #vapenation  #vaper  #vapes  #vapers  #vapeon  #vapefam  #vapelife  #vgod  #vgodnation  #vgodtricklyfe  #indovape  #malaysianvapers  #graffitiart  #vapecommunity  #vaping  #vapingtricks  #vapingcommunity  #coilporn  #driplyfe  #handcheck  #handchecks  #vapefriends  #malaysiavape  #indonesiavapor  #instavape  #satisfying 

@Regrann from @vienna_vapeteam - [Werbung / Markenerkennung]
[Advertising / Brand recognition]
__________

Coconut🥥 +Apple🍏+ Guava🍈 = perfect 🤟
__________

Brand: @liquidvoyage 
#vape#vapeon#vapefam#vapenation #vapecommunity #vapeporn#vapeing#vapetricks #vapeshop#vapegirl#vapegirls#vapetricks#vapeworld#coil#coilart#coilporn#coilbuilds #squonk #provape #coilmaster #vapergirl #ejuice  #vienna#gunporn #picoftheday #blog #instagood #clouds --------------------------
🇦🇹 Austrian Chapter 🇦🇹
Captain:
@vienna_vapeteam
——————————
The Crew:
@autvapeteam
@vienna_coils
@max_vpr
@casual_dryhit
@le_bierbaum_photography
@vapors_lifestyle
@austriavape
@ziggy_vapes
@vape_on_and_have_fun
@to.koenig.m
@kathi_vapes
@austrianvapeaholic
@snipez_vapes
@gentalmansvape

@Regrann from @vienna_vapeteam - [Werbung / Markenerkennung] [Advertising / Brand recognition] __________ Coconut🥥 +Apple🍏+ Guava🍈 = perfect 🤟 __________ Brand: @liquidvoyage #vape #vapeon #vapefam #vapenation  #vapecommunity  #vapeporn #vapeing #vapetricks  #vapeshop #vapegirl #vapegirls #vapetricks #vapeworld #coil #coilart #coilporn #coilbuilds  #squonk  #provape  #coilmaster  #vapergirl  #ejuice  #vienna #gunporn  #picoftheday  #blog  #instagood  #clouds  -------------------------- 🇦🇹 Austrian Chapter 🇦🇹 Captain: @vienna_vapeteam —————————— The Crew: @autvapeteam @vienna_coils @max_vpr @casual_dryhit @le_bierbaum_photography @vapors_lifestyle @austriavape @ziggy_vapes @vape_on_and_have_fun @to.koenig.m @kathi_vapes @austrianvapeaholic @snipez_vapes @gentalmansvape

PUKKA JUICE
@pukka.juice

Nochmal nen Bild vom #rainbowblaze bevor es leer ist  und die Flasche komplett penetriert wurde 🙈😅 .
. ~~~~~~~~~~~~~~~~~
.
ƬΉΣ ПΛƬIӨП

@vape_nation_germany .
~~~~~~~~~~~~~~~~~
˜”*°•.˜”*°• The Captains •°*”˜.•°*”˜ @soulvape__
@osvapedesign
@uemit.vapez
.
~~~~~~~~~~~~~~~~~
˜”*°•.˜”*°• The Member •°*”˜.•°*”˜ @dede_davito 
@vaping_peet 
@electrochica1509
@tammy_vape_fox
@sonnyvape
@sparrowstina 
@madame_dampfi
@_cipivape_
@psy_vape_babe 
@happy.vapor
@pippapuff
@buntkontrast 
@xmel_from_hellx
@andibinich 
@consti_vape
@mie_zii
@frisian_vape
@vape_zor
@steamcloudz
@freuulein_vape
@ninas.clouds
@abstract_vape_art 
@snw.wth.blck
. ˜”*°•.˜”*°• The Special Photograph •°*”˜.•°*”˜ @grosskopf_photography
~~~~~~~~~~~~~~~~~ .
˜”*°•.˜”*°• The Cooperation •°*”˜.•°*”˜ @powercigs 
@lynden_vapeculture
@joys_of_liquid_
@paromaz.de
@madvapes.de
.
˜”*°•.˜”*°• The Outfitter •°*”˜.•°*”˜ @xeinhalb .

#vape_nation_germany #vapefam #vapeporn #vapefriends 
#vapecommunity #vape #Germanvapers #vapers #vapelifestyle #vapenation #vapefamous #vapelove #vapesociety #dampfen #dampfer
#vapeworld #vapepics #vapestagram #vapelyfe
#vapegermany #vapeinsta #vape💨 #vapedaily #vapehooligans #vaporizer #ejuice 
#vapetricks #germanvapers #vapeon ↗️➡️unbezahlte Werbung ohne Nikotin ⬅️↖️
______________________🔞_____________________

PUKKA JUICE @pukka.juice Nochmal nen Bild vom #rainbowblaze  bevor es leer ist und die Flasche komplett penetriert wurde 🙈😅 . . ~~~~~~~~~~~~~~~~~ . ƬΉΣ ПΛƬIӨП @vape_nation_germany . ~~~~~~~~~~~~~~~~~ ˜”*°•.˜”*°• The Captains •°*”˜.•°*”˜ @soulvape__ @osvapedesign @uemit.vapez . ~~~~~~~~~~~~~~~~~ ˜”*°•.˜”*°• The Member •°*”˜.•°*”˜ @dede_davito @vaping_peet @electrochica1509 @tammy_vape_fox @sonnyvape @sparrowstina @madame_dampfi @_cipivape_ @psy_vape_babe @happy.vapor @pippapuff @buntkontrast @xmel_from_hellx @andibinich @consti_vape @mie_zii @frisian_vape @vape_zor @steamcloudz @freuulein_vape @ninas.clouds @abstract_vape_art @snw.wth.blck . ˜”*°•.˜”*°• The Special Photograph •°*”˜.•°*”˜ @grosskopf_photography ~~~~~~~~~~~~~~~~~ . ˜”*°•.˜”*°• The Cooperation •°*”˜.•°*”˜ @powercigs @lynden_vapeculture @joys_of_liquid_ @paromaz.de @madvapes.de . ˜”*°•.˜”*°• The Outfitter •°*”˜.•°*”˜ @xeinhalb . #vape_nation_germany  #vapefam  #vapeporn  #vapefriends  #vapecommunity  #vape  #Germanvapers  #vapers  #vapelifestyle  #vapenation  #vapefamous  #vapelove  #vapesociety  #dampfen  #dampfer  #vapeworld  #vapepics  #vapestagram  #vapelyfe  #vapegermany  #vapeinsta  #vape 💨 #vapedaily  #vapehooligans  #vaporizer  #ejuice  #vapetricks  #germanvapers  #vapeon  ↗️➡️unbezahlte Werbung ohne Nikotin ⬅️↖️ ______________________🔞_____________________

Dᴀs ᴡᴀʀ ᴅᴇʀ Dᴏɴɴᴇʀsᴛᴀɢ 😁🤙🏻
Sᴄʜᴏ̈ɴᴇɴ Aʙᴇɴᴅ ɴᴏᴄʜ 👊🏻💨💨💨
.
𝕮𝖍𝖊𝖈𝖐 𝖔𝖚𝖙 𝖙𝖍𝖊 𝖋𝖆𝖒𝖎𝖑𝖞
⚔
@drako_militia_europe
⚔
ℭ𝔬𝔪𝔪𝔞𝔫𝔡𝔢𝔯
@drako_nachtwacht_vaping
⚔
ℭ𝔬-ℭ𝔬𝔪𝔪𝔞𝔫𝔡𝔢𝔯
@drako_bigfootvapes7
@drako_s.n.a.f.t.y
⚔
𝔐𝔞𝔧𝔬𝔯
@drako_warrior_ohm_wheels (UK)
@ak.vapez_drako (GER/AUT)
@drako_unicorn (SUI/ESP/ITA/PRT)
@l.a.s.o.v.a.p.e.z_drako (GER/AUT)
⚔
ℭ𝔞𝔭𝔱𝔞𝔦𝔫𝔰
@oby.x.zedd (NL)
@thedre4dful (FRA)
@bvmvanmeldert_drako (GER/AUT)
@vicmackey84_drako (UK)
@ryansvapes_drako_tbz (UK)
@maximilion_vii (ITA)
@drako_steambull (GER/AUT)
@mazz.barny.boo (UK)
⚔
ℭ𝔬-ℭ𝔞𝔭𝔱𝔞𝔦𝔫𝔰
@dme187_drako (GER/AUT)
@dampfbinchen_drako (GER/AUT)
@dynamic_vaper (ITA)
@drogonkoil_drakoeurope (FRA)
@vaping_heathen_hart_77(UK)
@drako_steam_couple2k18 (GER/AUT)
@drako_nadiel (UK)
@terry_p69 (UK)
⚔
𝔊𝔢𝔯𝔪𝔞𝔫𝔦𝔠 𝔠𝔥𝔞𝔭𝔱𝔢𝔯
⚔
𝔖𝔢𝔯𝔤𝔢𝔞𝔫𝔱
@drako_db_steamer
@drako_schaaubster
@c.scorpionking.drako
@cervino_clouds
@kazeros
@drako_vaporfranky
@drako_aggro_banana
@drako_outlaw_coils
@dampfmalschoen
⚔
𝔖𝔬𝔩𝔡𝔦𝔢𝔯𝔰
@king_vnmldrt_drako_de
@Zero_Ohmz
@drako_bj_queen
@marc_fvape_drako
@swaaag_inc
@drako_django_aka_dampfdosen
@crazy_da_original_drako
@pranga_007
@Drako_Henne_NB 
@baltic_braids
@drako_dampfmann01
@omata_vape_room
@drako_dampfbartcoils
@paradiescoils_drako
@chrisse86
@vapingstu1909_drako
@drako_raph
@dampf_dude
⚔
𝔓𝔯𝔬𝔰𝔭𝔢𝔠𝔱𝔰
@poely87
@daddy_bam_bam
@cloud_inspecta1
@cello_ohms
@steam_grave
@simpleon.vaper
@13ate_vaping
@knaanaslan
⚔
@drakomilitia
www.drakomilitia.com
@cityvapesnl
www.cityvapes.nl
*
𝐇𝐚𝐬𝐡𝐭𝐚𝐠𝐬:
#drakomilitiaeurope #drakolife #teamdrako
#drakosoldier #dmevapeforheroes #vape #vapeblog #picoftheday #instavape #cloudlove #vapeon #vapeguys #vapegirls #instacloud #vapepics #vapeart #inkedvaper  #vapecommunity #vapedaily #socialvape #vapegram #vapefameous #vapeporn #vapelyfe  #vapemodels #vapebabes #vapephotography #vapefam  #vapenation #dampfer

Dᴀs ᴡᴀʀ ᴅᴇʀ Dᴏɴɴᴇʀsᴛᴀɢ 😁🤙🏻 Sᴄʜᴏ̈ɴᴇɴ Aʙᴇɴᴅ ɴᴏᴄʜ 👊🏻💨💨💨 . 𝕮𝖍𝖊𝖈𝖐 𝖔𝖚𝖙 𝖙𝖍𝖊 𝖋𝖆𝖒𝖎𝖑𝖞 ⚔ @drako_militia_europe ⚔ ℭ𝔬𝔪𝔪𝔞𝔫𝔡𝔢𝔯 @drako_nachtwacht_vaping ⚔ ℭ𝔬-ℭ𝔬𝔪𝔪𝔞𝔫𝔡𝔢𝔯 @drako_bigfootvapes7 @drako_s.n.a.f.t.y ⚔ 𝔐𝔞𝔧𝔬𝔯 @drako_warrior_ohm_wheels (UK) @ak.vapez_drako (GER/AUT) @drako_unicorn (SUI/ESP/ITA/PRT) @l.a.s.o.v.a.p.e.z_drako (GER/AUT) ⚔ ℭ𝔞𝔭𝔱𝔞𝔦𝔫𝔰 @oby.x.zedd (NL) @thedre4dful (FRA) @bvmvanmeldert_drako (GER/AUT) @vicmackey84_drako (UK) @ryansvapes_drako_tbz (UK) @maximilion_vii (ITA) @drako_steambull (GER/AUT) @mazz.barny.boo (UK) ⚔ ℭ𝔬-ℭ𝔞𝔭𝔱𝔞𝔦𝔫𝔰 @dme187_drako (GER/AUT) @dampfbinchen_drako (GER/AUT) @dynamic_vaper (ITA) @drogonkoil_drakoeurope (FRA) @vaping_heathen_hart_77(UK) @drako_steam_couple2k18 (GER/AUT) @drako_nadiel (UK) @terry_p69 (UK) ⚔ 𝔊𝔢𝔯𝔪𝔞𝔫𝔦𝔠 𝔠𝔥𝔞𝔭𝔱𝔢𝔯 ⚔ 𝔖𝔢𝔯𝔤𝔢𝔞𝔫𝔱 @drako_db_steamer @drako_schaaubster @c.scorpionking.drako @cervino_clouds @kazeros @drako_vaporfranky @drako_aggro_banana @drako_outlaw_coils @dampfmalschoen ⚔ 𝔖𝔬𝔩𝔡𝔦𝔢𝔯𝔰 @king_vnmldrt_drako_de @Zero_Ohmz @drako_bj_queen @marc_fvape_drako @swaaag_inc @drako_django_aka_dampfdosen @crazy_da_original_drako @pranga_007 @Drako_Henne_NB @baltic_braids @drako_dampfmann01 @omata_vape_room @drako_dampfbartcoils @paradiescoils_drako @chrisse86 @vapingstu1909_drako @drako_raph @dampf_dude ⚔ 𝔓𝔯𝔬𝔰𝔭𝔢𝔠𝔱𝔰 @poely87 @daddy_bam_bam @cloud_inspecta1 @cello_ohms @steam_grave @simpleon.vaper @13ate_vaping @knaanaslan ⚔ @drakomilitia www.drakomilitia.com @cityvapesnl www.cityvapes.nl * 𝐇𝐚𝐬𝐡𝐭𝐚𝐠𝐬: #drakomilitiaeurope  #drakolife  #teamdrako  #drakosoldier  #dmevapeforheroes  #vape  #vapeblog  #picoftheday  #instavape  #cloudlove  #vapeon  #vapeguys  #vapegirls  #instacloud  #vapepics  #vapeart  #inkedvaper  #vapecommunity  #vapedaily  #socialvape  #vapegram  #vapefameous  #vapeporn  #vapelyfe  #vapemodels  #vapebabes  #vapephotography  #vapefam  #vapenation  #dampfer 

This is so good I cant stop watching it. Sorry I havent posted my life is falling apart again !!! Haha as per usual :))
♡
•
♡
•
♡
•
♡
•
♡
•
♡
•
#memes #memesdaily #spicy #spicymemes #ass #h3h3 #idubbbz #filthyfrank #goodmemes #wholesomememes #cancer #funny #funnymemes #insta #ig #instagram #music #wow #contentawarescale #yeehaw #vape #vapenaysh #goodmemes #skateboard #tylerone #whereisit #owned #trending #explorepage

This is so good I cant stop watching it. Sorry I havent posted my life is falling apart again !!! Haha as per usual :)) ♡ • ♡ • ♡ • ♡ • ♡ • ♡ • #memes  #memesdaily  #spicy  #spicymemes  #ass  #h3h3  #idubbbz  #filthyfrank  #goodmemes  #wholesomememes  #cancer  #funny  #funnymemes  #insta  #ig  #instagram  #music  #wow  #contentawarescale  #yeehaw  #vape  #vapenaysh  #goodmemes  #skateboard  #tylerone  #whereisit  #owned  #trending  #explorepage 

😎💨💨
New double uptake recycler style in. Swipe to see the functions videos. This things crazy! We only have one of these so don't sleep on it. Hit the Dm for info.
.
🎨 by @slugworthglass420 .
.
#Wynwood #Miami #WynwoodsGnV  #soflodabbers #GlassForSale #ArtForSale #Vape #Smoke #CBD #Florida  #WynwoodWalls #WynwoodArt #Graffiti #StreetArt #WallArt #DowntownMiami #MidTownMiami #MiamiSmokeShop  #HeadyGlass #Dabs #rigs #710 #420 #art #VapeWynwood #WynwoodMiami #SmokeWynwood #WynwoodSmokeShop

😎💨💨 New double uptake recycler style in. Swipe to see the functions videos. This things crazy! We only have one of these so don't sleep on it. Hit the Dm for info. . 🎨 by @slugworthglass420 . . #Wynwood  #Miami  #WynwoodsGnV   #soflodabbers  #GlassForSale  #ArtForSale  #Vape  #Smoke  #CBD  #Florida   #WynwoodWalls  #WynwoodArt  #Graffiti  #StreetArt  #WallArt  #DowntownMiami  #MidTownMiami  #MiamiSmokeShop   #HeadyGlass  #Dabs  #rigs  #710  #420  #art  #VapeWynwood  #WynwoodMiami  #SmokeWynwood  #WynwoodSmokeShop 

Legal marijuana companies are cautiously welcoming California Gov. Gavin Newsom’s announcement that 150 National Guard troops will deploy to Northern Californiato “go after illegal cannabis farms,” but the news also is kindling fears in some industry circles of a renewed, government-led drug war.
Many legal marijuana companies have long argued that illicit operators pose a major threat to their bottom line – and a widespread law enforcement conundrum for the state at large.
However, some of California’s legal cannabis companies remain unclear about how the National Guard effort will proceed, and the state has yet to offer clear-cut answers.
Parallels drawn to the decades-old Campaign Against Marijuana Planting program (CAMP) have some worried about a “drug war 2.0” because in years past, CAMP arguably victimized many of the same MJ farmers who are now legal and licensed.
Cannabis companies also are looking for clarity from the state about how the deployment will be managed to ensure it doesn’t unintentionally interfere with legal marijuana businesses.
It’s also unclear whether the deployment may lead to raids on some farms that may be out of compliance with state industry rules but are still transitioning and trying to become part of the legal market.
Memories of CAMP, in particular, are triggering alarms.
“CAMP … sends shivers up my spine just hearing it,” said John Brower, a cannabis industry consultant in Trinity County, which comprises the Emerald Triangle along with Humboldt and Mendocino counties.
-----------------------------------------------------------------
#cannabis #marijuana #cannabisnews #marijuananews #kush #indica #sativa #thc #cbd #cannabinoids #terps #terpenes #dabs #vape #sesh #edibles #cannabisindustry #cannabusiness #cannabiz #cannabiscommunity #sandiegocannabisindustry #sandiegocannabiscommunity #californiacannabiscommunity #californiacannabisindustry #california #humboldt #mendocino #emeraldtriangle

Legal marijuana companies are cautiously welcoming California Gov. Gavin Newsom’s announcement that 150 National Guard troops will deploy to Northern Californiato “go after illegal cannabis farms,” but the news also is kindling fears in some industry circles of a renewed, government-led drug war. Many legal marijuana companies have long argued that illicit operators pose a major threat to their bottom line – and a widespread law enforcement conundrum for the state at large. However, some of California’s legal cannabis companies remain unclear about how the National Guard effort will proceed, and the state has yet to offer clear-cut answers. Parallels drawn to the decades-old Campaign Against Marijuana Planting program (CAMP) have some worried about a “drug war 2.0” because in years past, CAMP arguably victimized many of the same MJ farmers who are now legal and licensed. Cannabis companies also are looking for clarity from the state about how the deployment will be managed to ensure it doesn’t unintentionally interfere with legal marijuana businesses. It’s also unclear whether the deployment may lead to raids on some farms that may be out of compliance with state industry rules but are still transitioning and trying to become part of the legal market. Memories of CAMP, in particular, are triggering alarms. “CAMP … sends shivers up my spine just hearing it,” said John Brower, a cannabis industry consultant in Trinity County, which comprises the Emerald Triangle along with Humboldt and Mendocino counties. ----------------------------------------------------------------- #cannabis  #marijuana  #cannabisnews  #marijuananews  #kush  #indica  #sativa  #thc  #cbd  #cannabinoids  #terps  #terpenes  #dabs  #vape  #sesh  #edibles  #cannabisindustry  #cannabusiness  #cannabiz  #cannabiscommunity  #sandiegocannabisindustry  #sandiegocannabiscommunity  #californiacannabiscommunity  #californiacannabisindustry  #california  #humboldt  #mendocino  #emeraldtriangle 

Unbezahlte Werbung, dieses Produkt enthält kein Nikotin. Von Kooky vapes, Bluegrape Madness 😋😋😋😋 mehr muss ich nicht sagen 😍
@kookyvapes 
#kookyvapes #bluegrapemadness #vape #vaping #dampfen #dampfguenstig #vapeporn #vapegirl #vapepicture #vapefam #vapefamily #vapepromo #vapestergram #vapesexy #vapeon #dampfenstattrauchen #vapeon #vapeonly #unbezaltewerbung #vepepics #ezigarette #cloud #girlswhovape #vapers #vapingtime

Unbezahlte Werbung, dieses Produkt enthält kein Nikotin. Von Kooky vapes, Bluegrape Madness 😋😋😋😋 mehr muss ich nicht sagen 😍 @kookyvapes #kookyvapes  #bluegrapemadness  #vape  #vaping  #dampfen  #dampfguenstig  #vapeporn  #vapegirl  #vapepicture  #vapefam  #vapefamily  #vapepromo  #vapestergram  #vapesexy  #vapeon  #dampfenstattrauchen  #vapeon  #vapeonly  #unbezaltewerbung  #vepepics  #ezigarette  #cloud  #girlswhovape  #vapers  #vapingtime 

Posted @withrepost • @tokesoaks Giveaway time! This is for the winner second pic is the runner up package! Runner up package includes medicated maple syrup from @violetflamemedicinals earrings from @nativegypsyjewelry @tokesoaks bathbimb CBD healing topical from @basicallnaturalskincare and a water pipe!In order to enter you must follow all companies involved and make sure u have notifications turned on for tokesoaks! We have @violetflamemedicinals that donated CBD agave syrup @treatyerselfaccessories that donated a dabbed/bowl poker handmade with love, some beautiful earrings from @nativegypsyjewelry , CBD protein powder from @papa_mia311 , infused face syrup from @queen_canna_ ,some CBD coffee soap and lip balm from @basicallnaturalskincare and tons of stuff I put together for u guys! MUST TAG 3 people to enter, SHARES GET AN EXTRA ENTRY!!! Must follow @queen_canna_ @papa_mia311 @violetflamemedicinals @nativegypsyjewelry @treatyerselfaccessories @basicallnaturalskincare and of course @tokesoaks giveaway will end on 4/20!!! #getschwifty #giveaway #cbd #thc #edibles #glass #stayhigh #womenofcannabis #cannabis #blunts #vape #medicated #bathbomb #instagood #picoftheday #stoner #girlswhosmoke #share

Posted @withrepost • @tokesoaks Giveaway time! This is for the winner second pic is the runner up package! Runner up package includes medicated maple syrup from @violetflamemedicinals earrings from @nativegypsyjewelry @tokesoaks bathbimb CBD healing topical from @basicallnaturalskincare and a water pipe!In order to enter you must follow all companies involved and make sure u have notifications turned on for tokesoaks! We have @violetflamemedicinals that donated CBD agave syrup @treatyerselfaccessories that donated a dabbed/bowl poker handmade with love, some beautiful earrings from @nativegypsyjewelry , CBD protein powder from @papa_mia311 , infused face syrup from @queen_canna_ ,some CBD coffee soap and lip balm from @basicallnaturalskincare and tons of stuff I put together for u guys! MUST TAG 3 people to enter, SHARES GET AN EXTRA ENTRY!!! Must follow @queen_canna_ @papa_mia311 @violetflamemedicinals @nativegypsyjewelry @treatyerselfaccessories @basicallnaturalskincare and of course @tokesoaks giveaway will end on 4/20!!! #getschwifty  #giveaway  #cbd  #thc  #edibles  #glass  #stayhigh  #womenofcannabis  #cannabis  #blunts  #vape  #medicated  #bathbomb  #instagood  #picoftheday  #stoner  #girlswhosmoke  #share 

😙😗 Jumma Mubarak To My Friends. Duwa Me Yaad Rakhna 🐯👊Vr 78👊🐯On Ass Group 🐯👊#modelswanted #naturephotography #love #rumana #awaiz #d #m #dailyart #likeforlikes #like4likes #likeforlikeback #followforfollowback #followers #follback #hairstyles #naturelovers #u #vape #picoftheday #hairoftheday #redlover #following #followfollowfollow #ballislife #liketime #followbackinstantly #instafashion #hadrianswall #likeforfollow #follow4followback
VAPE PEN 22 SMOK 💨
----------------------------------------------------
COMPRAS 📲 DIRECT
📲(11) 99927-0420 whats ✓
📲(11) 98425-3173 whats ✓

Acessem nosso site 👇🏾
https://tabachronic.mercadoshops.com.br/

ROUPAS & ACESSÓRIOS
SIGAM 👉 @tabachronic_cotia
SIGAM 👉 @tabachronic_sma

proibido a venda para menores 🔞
----------------------------------------------------
#tabacaria #chronic #420 #tabachronic #cotia #sma #carapicuiba #vape #smok #pen22 #nargalife #smoke

VAPE PEN 22 SMOK 💨 ---------------------------------------------------- COMPRAS 📲 DIRECT 📲(11) 99927-0420 whats ✓ 📲(11) 98425-3173 whats ✓ Acessem nosso site 👇🏾 https://tabachronic.mercadoshops.com.br/ ROUPAS & ACESSÓRIOS SIGAM 👉 @tabachronic_cotia SIGAM 👉 @tabachronic_sma proibido a venda para menores 🔞 ---------------------------------------------------- #tabacaria  #chronic  #420  #tabachronic  #cotia  #sma  #carapicuiba  #vape  #smok  #pen22  #nargalife  #smoke 

TROPICAL delicioso líquido de naranja, toronja y granadina. Te esperamos en @vapemeupgt con la mejor atención al cliente!!
*disponible en dinamia y muxbal*

#vapemeup #vape #vapeporn #vapelife #vapecommunity #vapefam #guatemala #vapeon #vaping #instavape #vapor #subohm #vapedaily #ejuice #vapenation #cloudchaser #eliquid #guatemalacity #vapeshop #perhapsyouneedalittleguatemala #ecig #vapepics #clouds #vapelove #worldvaporexpo #handcheck #vapefriends #vapers

TROPICAL delicioso líquido de naranja, toronja y granadina. Te esperamos en @vapemeupgt con la mejor atención al cliente!! *disponible en dinamia y muxbal* #vapemeup  #vape  #vapeporn  #vapelife  #vapecommunity  #vapefam  #guatemala  #vapeon  #vaping  #instavape  #vapor  #subohm  #vapedaily  #ejuice  #vapenation  #cloudchaser  #eliquid  #guatemalacity  #vapeshop  #perhapsyouneedalittleguatemala  #ecig  #vapepics  #clouds  #vapelove  #worldvaporexpo  #handcheck  #vapefriends  #vapers 

Vaporesso swag kit
Up to 80w
Small and lovely
-----------------------------------
♨️ویپ اسواگ(سواگ) از برند ویپراسو
♨️تنظیم تا ۸۰ وات
♨️کوچک و خاص
♨️کامدهی عالی
-----------------------------------
🚩♨️رنگ:مشکی/مشکی رد دویل/ طلایی
💲قیمت به همراه باطری :۶۹۰ هزتر تومان 💲
-----------------------------------
📫جهت سفارش و اطلاعات بیشتر از طریق تلگرام یا  tam tam یا راه های زیر پیغام دهید

Whatsapp: 09332819137
Google allo: 09332819137

#vape#ismokeland #vapeiran #ویپ#ایران#سواگ#swag#vaporesso

Vaporesso swag kit Up to 80w Small and lovely ----------------------------------- ♨️ویپ اسواگ(سواگ) از برند ویپراسو ♨️تنظیم تا ۸۰ وات ♨️کوچک و خاص ♨️کامدهی عالی ----------------------------------- 🚩♨️رنگ:مشکی/مشکی رد دویل/ طلایی 💲قیمت به همراه باطری :۶۹۰ هزتر تومان 💲 ----------------------------------- 📫جهت سفارش و اطلاعات بیشتر از طریق تلگرام یا  tam tam یا راه های زیر پیغام دهید Whatsapp: 09332819137 Google allo: 09332819137 #vape #ismokeland  #vapeiran  #ویپ #ایران #سواگ #swag #vaporesso 

HAPPY BIRTHDAY TO MEEEEEEEEE 🎂 🎁 ‼️ Thank you to my Liquid Labs family for my princess themed celebration!!💯 They know how sassy I can be 🥳😎🤗#vape #vapor #vapelife #calivapors #vapeporn #handcheck #vapedaily #vapefeed #instavape #vaping #localvape #girlswhovape #vapechicks #vapemodels #vapelyfe #vapestagram #vapeon #vapeshop #ukvapers #ecig #ecigarette #eliquid #liquidlabs #neverforgotten #vapekeepit100 #keepit100

HAPPY BIRTHDAY TO MEEEEEEEEE 🎂 🎁 ‼️ Thank you to my Liquid Labs family for my princess themed celebration!!💯 They know how sassy I can be 🥳😎🤗#vape  #vapor  #vapelife  #calivapors  #vapeporn  #handcheck  #vapedaily  #vapefeed  #instavape  #vaping  #localvape  #girlswhovape  #vapechicks  #vapemodels  #vapelyfe  #vapestagram  #vapeon  #vapeshop  #ukvapers  #ecig  #ecigarette  #eliquid  #liquidlabs  #neverforgotten  #vapekeepit100  #keepit100 

Un silencio mental... Un silencio que se pierde cuando escribo, dibujo o juego. De pronto todo es gritos en mi mente, gritos fuertes que me dicen como actuar o moverme. Pero al terminar... De nuevo estoy en modo piloto automático haciendo la rutina, y de nuevo hay silencio, silencio que aturde y desorienta. (sólo es vapor, di NO a las drogas)
.
.
.
#guatemala #tumblr #smoke #nigga #thug #gang #pink #eyes #vape #like4like #guate #travel #tbt #dark #sad #mood

Un silencio mental... Un silencio que se pierde cuando escribo, dibujo o juego. De pronto todo es gritos en mi mente, gritos fuertes que me dicen como actuar o moverme. Pero al terminar... De nuevo estoy en modo piloto automático haciendo la rutina, y de nuevo hay silencio, silencio que aturde y desorienta. (sólo es vapor, di NO a las drogas) . . . #guatemala  #tumblr  #smoke  #nigga  #thug  #gang  #pink  #eyes  #vape  #like4like  #guate  #travel  #tbt  #dark  #sad  #mood 

🔥SALE ALERT🔥

For the next TWO DAYS you can save 15% OFF all items at SeduceJuice.com - juice, hardware, refillables, and more! And yes, that's on top of the recent price drop on Seduce Juice Signatures!
-
Plus, you'll get 30% OFF all sale items on our sale page! E-liquids as low as $4.99 😍 -
And for the cherry on top, you'll get all of it with FREE SHIPPING thru this Friday - so hurry in! --------------------
www.seducejuice.com
--------------------

🔥SALE ALERT🔥 For the next TWO DAYS you can save 15% OFF all items at SeduceJuice.com - juice, hardware, refillables, and more! And yes, that's on top of the recent price drop on Seduce Juice Signatures! - Plus, you'll get 30% OFF all sale items on our sale page! E-liquids as low as $4.99 😍 - And for the cherry on top, you'll get all of it with FREE SHIPPING thru this Friday - so hurry in! -------------------- www.seducejuice.com --------------------

It’s time to start getting rid of that bad habit. Drop the pack and pick up a Rolo Badge. Perfect for starting off and we have a wide selection of juices to go along with it and right now it’s $6 off it’s original price!
•
•
•
WARNING: This product is intended to be used with products containing nicotine. Nicotine is an addictive chemical. For adult use only.
•
•
•
#vape #vapelife #vapeporn #ejuice #rolo #badge #vapeon #vapestyle #mod #highlife #highlifesmokeshop #highlifecentral #highsociety #charlotte #nc #qc #plazamidwood

It’s time to start getting rid of that bad habit. Drop the pack and pick up a Rolo Badge. Perfect for starting off and we have a wide selection of juices to go along with it and right now it’s $6 off it’s original price! • • • WARNING: This product is intended to be used with products containing nicotine. Nicotine is an addictive chemical. For adult use only. • • • #vape  #vapelife  #vapeporn  #ejuice  #rolo  #badge  #vapeon  #vapestyle  #mod  #highlife  #highlifesmokeshop  #highlifecentral  #highsociety  #charlotte  #nc  #qc  #plazamidwood 

#Repost @bluffsbrewingco.ca
• • • • •
The owner of this store stood outside having a smoke and when asked if he worked there his answer was "yes I own it". It is obviously not a legitimate business.  If you care to report it, the address is 2050 Steele's Ave West in Vaughan.  There is no signage to advert minors, just a bunch of outdated mods and likely stolen product. .
.
#bluffsbrewingco #ejuice #eliquid #ryerson
#torontovapers #notblowingsmoke #vapor
#ontariovapers #vapeshop #uoft #wethenorth 
#madeincanada #blowcloudsnotsmoke 
#vapecommunity #vapestagram #vapelyfe #vaping 
#vapefam #instavaperz #vapenation #centennial
#canadavapes #vapeon #canadianvaper 
#canadavapestoo #vapestrong #yorku
#vape #vaping

#Repost  @bluffsbrewingco.ca • • • • • The owner of this store stood outside having a smoke and when asked if he worked there his answer was "yes I own it". It is obviously not a legitimate business. If you care to report it, the address is 2050 Steele's Ave West in Vaughan. There is no signage to advert minors, just a bunch of outdated mods and likely stolen product. . . #bluffsbrewingco  #ejuice  #eliquid  #ryerson  #torontovapers  #notblowingsmoke  #vapor  #ontariovapers  #vapeshop  #uoft  #wethenorth  #madeincanada  #blowcloudsnotsmoke  #vapecommunity  #vapestagram  #vapelyfe  #vaping  #vapefam  #instavaperz  #vapenation  #centennial  #canadavapes  #vapeon  #canadianvaper  #canadavapestoo  #vapestrong  #yorku  #vape  #vaping 

from @veteranclouds_planb -  Soo pretty
www.planbsupplyco.com 
@planbsupplyco
#guyswhovape #vapedaily #smoketricks #vape #vapelife #vapefam #vapecommunity #vapestagram #instafamous #vapelyfe #cloudchasing #ejuice #girlswhovape #instavape #tricklyfe #vapetricks #vapedaily #vapenationuk #vapepics #vapelove #vapehooligans #unityinthecommun #vapeworld #vapeshops #lovevaping #fuckbigtobacco #newyearnewme

Doc's Army
Werbung/ Advertisement!
Hey there, had a good day?
My evening ends with some delightful Strawberry Milk, what‘s your prefered flavour for your vape? 🍓 ━━━━━━━━━━━━━━━
@met4vapor 
@saveurvape ━━━━━━━━━━━━━━━
#Met4Vapor #saveurvape #strawberry #milk #vapeporn #vapelove #vapelyfe #vapeaddict #dampfen #blog #vapepics #vape #ukvapers  #productshot #lifestyleblogger #vapephotography #balivape #lifestyleblog #vapeart #instadaily #vapenation #germanvapers #chinavape #vapefeed #vapeaddicted #vapeaddict #canon #milkshake

Werbung/ Advertisement! Hey there, had a good day? My evening ends with some delightful Strawberry Milk, what‘s your prefered flavour for your vape? 🍓 ━━━━━━━━━━━━━━━ @met4vapor @saveurvape ━━━━━━━━━━━━━━━ #Met4Vapor  #saveurvape  #strawberry  #milk  #vapeporn  #vapelove  #vapelyfe  #vapeaddict  #dampfen  #blog  #vapepics  #vape  #ukvapers  #productshot  #lifestyleblogger  #vapephotography  #balivape  #lifestyleblog  #vapeart  #instadaily  #vapenation  #germanvapers  #chinavape  #vapefeed  #vapeaddicted  #vapeaddict  #canon  #milkshake 

Life goals: be as care free as this patron was!
Stop by @bluemartinivegas tonight and become one with the clouds through our exclusive @shishabucks hookahs!
🎧 @oskarkonne
🎧 @djgilbarba
🎧 @djtommylin
🎧 @djexile

Life goals: be as care free as this patron was! Stop by @bluemartinivegas tonight and become one with the clouds through our exclusive @shishabucks hookahs! 🎧 @oskarkonne 🎧 @djgilbarba 🎧 @djtommylin 🎧 @djexile

#Repost @meme_commander_snow
• • • • •
You've been badoofed
.
.
.
.
.
.
.
#laugh #offensive #offensivememes💦👀💯😂😂💎🔥😤💦👌💯😂🙏😂😂💎💎🔥😤💦👀👀 #offensivememes #funny #comedy #offensivememe
#edgymemes #edgy #funny #obunga #epicdadgrillfail #doyoukbowtheway #thanoscar #bongocat #vaporwave #weaboo #trapsaregay #minecraft #fortnite #vbucks #freevbucks #juul #vape #papafranku #vapenation #bushdid911 #bushdid911whichcausedthecivilwarwhichmadekanyewestsaygeorgebushhatesblackpeople

#Repost  @meme_commander_snow • • • • • You've been badoofed . . . . . . . #laugh  #offensive  #offensivememes 💦👀💯😂😂💎🔥😤💦👌💯😂🙏😂😂💎💎🔥😤💦👀👀 #offensivememes  #funny  #comedy  #offensivememe  #edgymemes  #edgy  #funny  #obunga  #epicdadgrillfail  #doyoukbowtheway  #thanoscar  #bongocat  #vaporwave  #weaboo  #trapsaregay  #minecraft  #fortnite  #vbucks  #freevbucks  #juul  #vape  #papafranku  #vapenation  #bushdid911  #bushdid911whichcausedthecivilwarwhichmadekanyewestsaygeorgebushhatesblackpeople 

who don't love a nice melon from the great guys at @mistiq_flava go check these guys out 👇Follow the mistiqflava uk team👇 
@lady_vaper
@jasonbasset1982_purge
@darrenbetley
@mistiq_flava 
@pete_tuck 
#guyswhovape #vape #handcheck #vapeon #vapeallday #vapecommunity #vapelife #vapegirls #vapenation #mistiqflava #vapelikeaboss #mistiqflavateamuk #vapelyfe #vapefam #instavape #notblowingsmoke #vapedaily #vapehooligans #vapelove #ejuice #vapesociety #healthy #vapefamous #subohm #eliquid #cloudchasing #mistiqflavaejuice #vapefriends #vapingisthefuture

who don't love a nice melon from the great guys at @mistiq_flava go check these guys out 👇Follow the mistiqflava uk team👇 @lady_vaper @jasonbasset1982_purge @darrenbetley @mistiq_flava @pete_tuck #guyswhovape  #vape  #handcheck  #vapeon  #vapeallday  #vapecommunity  #vapelife  #vapegirls  #vapenation  #mistiqflava  #vapelikeaboss  #mistiqflavateamuk  #vapelyfe  #vapefam  #instavape  #notblowingsmoke  #vapedaily  #vapehooligans  #vapelove  #ejuice  #vapesociety  #healthy  #vapefamous  #subohm  #eliquid  #cloudchasing  #mistiqflavaejuice  #vapefriends  #vapingisthefuture 

Thors Day vibes sporting my handmade mjolnir from the brother @thorsthreads with my Snow Wolf R, Detective Fat Bastard from @five0eliquid and Alfadhirhaiti from @amplifiedhistory to wake up the mind,soul and the blood. 
Follow the fam:👇👇👇
@cloudriderzuniqueww
@cloudriderzww
-----------------------------
#CRUWW 
#CLOUDRIDERZUNIQUEWW
-----------------------------
@kismet_kobain (PREZ)
@metaltatsnvaping (VP) 
@shilumz
@le_zap
@chasingg00se3ggs
@vlka_fenryka40
@lightmyvaping99 
@kangees.vizions_duvo
@dlvapes (pros) 
@domino_monochr0hm (pros) •
•
•
#vape #vapeporn #clouds #vapelife #dreamdrip100 #vapecommunity #vapefam #modlife  #vapehard #instavape #vapephotography  #vape #vapeon #vapeallday #vapenation #five0eliquid #lineoffireeliquid #oneloveonefam #vapefamily #vapeedit #heathen #thorsday #wolfofodin #mjolnir #ulfhedinn #ulfhednar #wolfcult

Thors Day vibes sporting my handmade mjolnir from the brother @thorsthreads with my Snow Wolf R, Detective Fat Bastard from @five0eliquid and Alfadhirhaiti from @amplifiedhistory to wake up the mind,soul and the blood. Follow the fam:👇👇👇 @cloudriderzuniqueww @cloudriderzww ----------------------------- #CRUWW  #CLOUDRIDERZUNIQUEWW  ----------------------------- @kismet_kobain (PREZ) @metaltatsnvaping (VP) @shilumz @le_zap @chasingg00se3ggs @vlka_fenryka40 @lightmyvaping99 @kangees.vizions_duvo @dlvapes (pros) @domino_monochr0hm (pros) • • • #vape  #vapeporn  #clouds  #vapelife  #dreamdrip100  #vapecommunity  #vapefam  #modlife   #vapehard  #instavape  #vapephotography   #vape  #vapeon  #vapeallday  #vapenation  #five0eliquid  #lineoffireeliquid  #oneloveonefam  #vapefamily  #vapeedit  #heathen  #thorsday  #wolfofodin  #mjolnir  #ulfhedinn  #ulfhednar  #wolfcult 

How Want This?
.
#🔞 AL SADARAH🔝 #SMOKING #🚬 ACCESSORIES L.L.C
.
🔞الصدارة🔝 #للدوخة و #المداويخ  ش.ذ.م.م
.
#TOBACCO & #CIGARETTES TRADING #WHOLESALE .
تجارة #التبغ المعالج و #السجائر بالجملة
.
#UAE #🇦🇪 - #DUBAI - #Al_RASHIDIYA - Near The Metro Station Rashidiyah 🚉 - Bin Eid Traditional Restaurant Souq - Shop #8
.
#امارات_متحدة_عربي 🇦🇪 #دبي - #الراشدية - قريب محطة مترو الراشدية🚝 - سوق مطعم بن عيد الشعبي - محل رقم 8
.
00971 52 293 0994
.
#مدواخ #الدوخة_للمدواخ #التبغ #السجائر #شيشة #دوخة
.
#Hookah #Medwakh #Medwakh_Tobacco #Dokha #Cigar #Shisha #Tobacco #Vape
.
https://sadarah-smoking-accessories.business.site/?m=true
.
https://goo.gl/maps/uH9cH2mG11s

How Want This? . #🔞 AL SADARAH🔝 #SMOKING  #🚬 ACCESSORIES L.L.C . 🔞الصدارة🔝 #للدوخة  و #المداويخ  ش.ذ.م.م . #TOBACCO  & #CIGARETTES  TRADING #WHOLESALE  . تجارة #التبغ  المعالج و #السجائر  بالجملة . #UAE  #🇦🇪 - #DUBAI  - #Al_RASHIDIYA  - Near The Metro Station Rashidiyah 🚉 - Bin Eid Traditional Restaurant Souq - Shop #8  . #امارات_متحدة_عربي  🇦🇪 #دبي  - #الراشدية  - قريب محطة مترو الراشدية🚝 - سوق مطعم بن عيد الشعبي - محل رقم 8 . 00971 52 293 0994 . #مدواخ  #الدوخة_للمدواخ  #التبغ  #السجائر  #شيشة  #دوخة  . #Hookah  #Medwakh  #Medwakh_Tobacco  #Dokha  #Cigar  #Shisha  #Tobacco  #Vape  . https://sadarah-smoking-accessories.business.site/?m=true . https://goo.gl/maps/uH9cH2mG11s

No USB charging necessary! Two Replaceable Batteries! ...and the ultimate wireless charging case for your spare battery, that can be wirelessly charged at any wireless dock! .
.
Our girl @crissy_vapes chooses #FREEDOM.  Freedom from USB Ports, Freedom from down-time associated with charging, Freedom to live her life, Fam! Choose Freedom, Fam!
.
.
ZEAL is available at www.usvofficial.com.  Use code:  USV2019 for an additional 10% OFF + FREE Domestic Shipping! 💨

No USB charging necessary! Two Replaceable Batteries! ...and the ultimate wireless charging case for your spare battery, that can be wirelessly charged at any wireless dock! . . Our girl @crissy_vapes chooses #FREEDOM . Freedom from USB Ports, Freedom from down-time associated with charging, Freedom to live her life, Fam! Choose Freedom, Fam! . . ZEAL is available at www.usvofficial.com. Use code: USV2019 for an additional 10% OFF + FREE Domestic Shipping! 💨

I always take my double barrel everywhere. Even though I can’t vape in my office, it still sits right here in front of me and stares 👀#neverleavehomewithoutit #dbv3 #tac21 #detonator #doublebarrel #squidindustries #vapewithsquid #squidvaporgroup #vapelife #vapenation #vapefam #vape #vapecommunity #vapeon #vapedaily #subohm #rta #rda #coilporn #eliquid #meshrda #meshtank #fireluke #veterans #military #usa #bluecollar #vape #vaper

I always take my double barrel everywhere. Even though I can’t vape in my office, it still sits right here in front of me and stares 👀#neverleavehomewithoutit  #dbv3  #tac21  #detonator  #doublebarrel  #squidindustries  #vapewithsquid  #squidvaporgroup  #vapelife  #vapenation  #vapefam  #vape  #vapecommunity  #vapeon  #vapedaily  #subohm  #rta  #rda  #coilporn  #eliquid  #meshrda  #meshtank  #fireluke  #veterans  #military  #usa  #bluecollar  #vape  #vaper 

This weekend @planbfamily_ia -  PlanB Supply co will be Vapor Mania Expo
this weekend in St Louis
2/23/19-2/24/19

Looking forward to seeing everyone there 
Www.planbsupplyco.com
💨👊💨👊💨👊💨👊💨www.planbsupplyco.com
@plan_b_social2019
@planbsupplyco
#FSU #planbfamily #planbsupplyco #planb #savefugazysliver #vapelyfe #vape #mmv #mmvvapor #planbfamily #vapelyfe #Vapehooligans #vapemods #vapelove #vapecommunity #unityinthecommunity #vapelife #guyswhovape #GirlsWhoVape #instafamous #followforfollowback #cloudchaser #cloudcomp #coilporn  Support:
@planbsupplyco
@planbcompteam_ia
@planbfamily_ia
@don_fugazy
@docpheelgood_planb
@jimmymc3_planb
@Sir_Sheibs_planb
@evan_planb
@BeardedCloudz_planb
@codywarren97_planb
@Kingcloud_planb
@Juggernaut_planb
@sara.vapes_planb
@cbradiobeats_planb
@Cakeclouds_planb
@Cdm514_planb
SPONSORS🤟💨
@mr.mrs.vaporium
@drshugarchitz

Doc's Army

This weekend @planbfamily_ia - PlanB Supply co will be Vapor Mania Expo this weekend in St Louis 2/23/19-2/24/19 Looking forward to seeing everyone there Www.planbsupplyco.com 💨👊💨👊💨👊💨👊💨www.planbsupplyco.com @plan_b_social2019 @planbsupplyco #FSU  #planbfamily  #planbsupplyco  #planb  #savefugazysliver  #vapelyfe  #vape  #mmv  #mmvvapor  #planbfamily  #vapelyfe  #Vapehooligans  #vapemods  #vapelove  #vapecommunity  #unityinthecommunity  #vapelife  #guyswhovape  #GirlsWhoVape  #instafamous  #followforfollowback  #cloudchaser  #cloudcomp  #coilporn  Support: @planbsupplyco @planbcompteam_ia @planbfamily_ia @don_fugazy @docpheelgood_planb @jimmymc3_planb @Sir_Sheibs_planb @evan_planb @BeardedCloudz_planb @codywarren97_planb @Kingcloud_planb @Juggernaut_planb @sara.vapes_planb @cbradiobeats_planb @Cakeclouds_planb @Cdm514_planb SPONSORS🤟💨 @mr.mrs.vaporium @drshugarchitz Doc's Army

Visit our online store today! We have a ton of options to fit your style. Tag us to be featured on our page! Link in bio. Stay high friends.

Visit our online store today! We have a ton of options to fit your style. Tag us to be featured on our page! Link in bio. Stay high friends.

😎 Bane 😎
It’s been a while.🤷🏼‍♂️
———————
@ponyboyvapes 🔥
———————
#vapecommunity #ejuice #vapelife #vapefam #vapehooligans #vapetricks #vapeporn #trickporn #tricklife #mods #officialvapetricks #cloudchaser #vapenation #vapepics #vapeaddicts #vapeon #vape #vaping #vapelove #ukvapers #indovapers #vgod #subohm #notblowingsmoke #vapelove

😎 Bane 😎 It’s been a while.🤷🏼‍♂️ ——————— @ponyboyvapes 🔥 ——————— #vapecommunity  #ejuice  #vapelife  #vapefam  #vapehooligans  #vapetricks  #vapeporn  #trickporn  #tricklife  #mods  #officialvapetricks  #cloudchaser  #vapenation  #vapepics  #vapeaddicts  #vapeon  #vape  #vaping  #vapelove  #ukvapers  #indovapers  #vgod  #subohm  #notblowingsmoke  #vapelove 

Raspberry and Pear combination mixed to perfection to quench your thirst! 💙💧💦
.
#thirsteliquid #elitevapecrew #eliquid #ejuice #ecig #ukvapers #ladyvapers #vapelife #vape #vapelifestyle #guyswhovape #girlswhovape #girlswhodrip #chickswithwicks #cloudchaser #vapefam #vapefriends #vapefamily #vapeon #vapeoftheday #vapestagram #instavape #instalike #vapejuice #vapebabes #adv #vapehappy #vapedaily
Mod or keyboard or both? 💜
☝ Link in bio to buy vapes
➡️ Follow @vapingseries for more🌬️ ⬅️
📸: @vafflecom

Mod or keyboard or both? 💜 ☝ Link in bio to buy vapes ➡️ Follow @vapingseries for more🌬️ ⬅️ 📸: @vafflecom

a thank you to the family @firehousevape ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬
Follow the team: 💀 @nohmads 💀 
@Vaper_M
@Rick_Gravestone
@El.Nestum 
@SinfullVaper
@Xana_vapes
@Vaper_Davz 
@Ftmvape
@Riccographer 
@Foxvape_1312
@secretly_vaper
Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω 
Follow the chapters:
🌐@nohmads
🇬🇧@nohmads.uk
Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω ΩΩ Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω 
#iamnohmad #nohmadsvc #fire #vape #vapelife #vapenation #vapeon #vapelyfe #vapefam #vapecommunity #vapedaily #vapestagram #vapelove #vapers #vaping #vaper #vapetricks #vapepics #instavape #vapesociety #vapefriends #vapeshop #vapor #vapehooligans #vapefamous #vapes #vapefamily #vapegram #vapeallday

a thank you to the family @firehousevape ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ Follow the team: 💀 @nohmads 💀 @Vaper_M @Rick_Gravestone @El.Nestum @SinfullVaper @Xana_vapes @Vaper_Davz @Ftmvape @Riccographer @Foxvape_1312 @secretly_vaper Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Follow the chapters: 🌐@nohmads 🇬🇧@nohmads.uk Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω ΩΩ Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω #iamnohmad  #nohmadsvc  #fire  #vape  #vapelife  #vapenation  #vapeon  #vapelyfe  #vapefam  #vapecommunity  #vapedaily  #vapestagram  #vapelove  #vapers  #vaping  #vaper  #vapetricks  #vapepics  #instavape  #vapesociety  #vapefriends  #vapeshop  #vapor  #vapehooligans  #vapefamous  #vapes  #vapefamily  #vapegram  #vapeallday